PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8735_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 596aa    MW: 67670 Da    PI: 7.2508
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8735_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.35.7e-18274358180
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                 f kvl+ sd+ k+g +vl k++a e+       ++    s++++ +d +gr+W++k++ r++++r+++++GW+eF+k ++L +gD++
  RrC8735_p1 274 FTKVLSDSDTRKNGGFVLYKRHAIEClplldmsQLT--PSQEIIAKDIHGREWSFKHTLRGTPKRHLFSSGWNEFAKGKELVAGDSF 358
                 89****************************965444..5669*******************************************96 PP

2Auxin_resp79.86.6e-27397475283
  Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  +a+++k++  v+Y+Pr+  s+F v+++k+++ +++k+s+G++f m+fe++d +e+r+ Gtvvgv+d+++ +W++S+WrsL+
  RrC8735_p1 397 LNAIRKKCMLVVFYKPRS--SQFLVNFDKFVDRVNNKFSIGSKFSMRFEGKDLNEIRYNGTVVGVRDFST-HWKDSEWRSLE 475
                 6899*************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.25.10.107.3E-503250IPR011989Armadillo-like helical
SuperFamilySSF483713.07E-378250IPR016024Armadillo-type fold
PfamPF016023.5E-459251IPR002553Clathrin/coatomer adaptor, adaptin-like, N-terminal
Gene3DG3DSA:2.40.330.103.4E-27265358IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-23271358IPR015300DNA-binding pseudobarrel domain
CDDcd100171.25E-15273363No hitNo description
SMARTSM010192.8E-10274374IPR003340B3 DNA binding domain
PROSITE profilePS5086310.123274386IPR003340B3 DNA binding domain
PfamPF023622.8E-15274358IPR003340B3 DNA binding domain
PfamPF065078.7E-24397474IPR010525Auxin response factor
PROSITE profilePS5174515.405485565IPR000270PB1 domain
SuperFamilySSF542774.02E-6490560No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006886Biological Processintracellular protein transport
GO:0009725Biological Processresponse to hormone
GO:0016192Biological Processvesicle-mediated transport
GO:0005634Cellular Componentnucleus
GO:0030117Cellular Componentmembrane coat
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MLFTCAEERA VNYLLSNVDK VSDWNESLQM VVLELIRSVC KTKPSEKGKY IKIIISLLSA  60
TSSAVIYECA GTLVSLSSAP TAIRAAANTY CQLLLSQSDN NVKLILLDRL SELKSSHRDI  120
MVELIIDVLR VLSSPNLDIR RKTLDIALDL ITHHNINEVV QMLKKEVVKT QSGELEKNGE  180
YRQMLIQAIH ACAVKFPEVA STVVHLLMDF LGDSNVASAL DVISFVREII ETNPKLRVSI  240
ITRLLDTFYQ IRAGKDVEIP IPKNKNNIQN INYFTKVLSD SDTRKNGGFV LYKRHAIECL  300
PLLDMSQLTP SQEIIAKDIH GREWSFKHTL RGTPKRHLFS SGWNEFAKGK ELVAGDSFRR  360
EWGIASCISK APHQQHNIPT SLISKQSMHH GVVATVLNAI RKKCMLVVFY KPRSSQFLVN  420
FDKFVDRVNN KFSIGSKFSM RFEGKDLNEI RYNGTVVGVR DFSTHWKDSE WRSLEVQWDG  480
AAIIPRPDKV HMEGVIERSV DLTIFDGYNQ LIDEIETLFD IKGELHMHDQ WKMFFIYDEG  540
DMMILGDDPW PKFCNMAKEI FICSKEDVKI GTADSRFSEG DPTLTTPILP PDVNSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5a1u_G5e-741255211468COATOMER SUBUNIT BETA
5a1v_G5e-741255211468COATOMER SUBUNIT BETA'
5a1v_O5e-741255211468COATOMER SUBUNIT BETA'
5a1v_X5e-741255211468COATOMER SUBUNIT BETA'
5a1w_G5e-741255211468COATOMER SUBUNIT BETA
5a1x_G5e-741255211468COATOMER SUBUNIT BETA
5a1x_O5e-741255211468COATOMER SUBUNIT BETA
5a1y_G5e-741255211468COATOMER SUBUNIT BETA
5a1y_O5e-741255211468COATOMER SUBUNIT BETA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2411840.0AC241184.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH111N19, complete sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35520.16e-86auxin response factor 15